fond ecran
Site under contruction


LORIA

MSVMpred

Protein Secondary Structure Prediction with M-SVMs
CNRS



Help page


Input sequence:

You should enter a single sequence, written in one or more lines. The sequence can be in the "raw" format or in FASTA format. In the last case, the description of the sequence will be ignored. Example of "raw" format: KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKG
PSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Example of FASTA format: >calcium binding protein
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKG
PSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Your sequence can either be typed or cut and pasted into the text box or be ulpoaded as a file.

Email address:

Optional. If you enter your email address, the results will be send to you as soon as possible.
Otherwise, they will be appear in the window from which you will be able to download them.